PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.176140.1
Common NameCsa_3G732480, LOC101215822
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 269aa    MW: 30011 Da    PI: 9.7562
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.176140.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.14e-082166346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT+eE +++ +a +++  +   +W ++a++++ g+t  +++  ++ 
   Cucsa.176140.1 21 KWTPEENKRFENALALFDIDtpdRWVKVAAMIP-GKTVCDVVKQYRE 66
                     8*****************99*************.***9999888875 PP

2Myb_DNA-binding47.15.5e-15127171347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
   Cucsa.176140.1 127 PWTEEEHRQFLMGLKKYGKGDWRNISRSFVTTRTPTQVASHAQKY 171
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.621772IPR017884SANT domain
SMARTSM007172.4E-71870IPR001005SANT/Myb domain
SuperFamilySSF466895.1E-122075IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-42168IPR009057Homeodomain-like
PfamPF002494.6E-62166IPR001005SANT/Myb domain
CDDcd001673.36E-72168No hitNo description
Gene3DG3DSA:1.10.10.608.3E-13118176IPR009057Homeodomain-like
PROSITE profilePS5129420.02120176IPR017930Myb domain
SuperFamilySSF466892.08E-17121175IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-17123175IPR006447Myb domain, plants
SMARTSM007175.6E-13124174IPR001005SANT/Myb domain
CDDcd001671.58E-11127172No hitNo description
PfamPF002492.1E-12127171IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MKRGIGILSP ATYLRNSGCS KWTPEENKRF ENALALFDID TPDRWVKVAA MIPGKTVCDV  60
VKQYRELVED VSDIEAGLVP VPGYGVGNSF VLEWSSDGGG FAPMYIGAGK RGGCGRPSDQ  120
ERKKGVPWTE EEHRQFLMGL KKYGKGDWRN ISRSFVTTRT PTQVASHAQK YFIRQLTGGK  180
DKRRSSIHDI TTTHLFDNSI NQPGNHDKTS PPSYVGVKMA PLCGISSLRP KLLQDQIFLR  240
SNNFHGCQNV NPYSPNIVFQ GQRDQQYQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1622841173RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818411e-180LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132581e-180LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004137732.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H79e-92DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0A0L9Y90.0A0A0A0L9Y9_CUCSA; Uncharacterized protein
STRINGPOPTR_0016s11980.11e-107(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2476233
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-99MYB family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]